PDB entry 261l

View 261l on RCSB PDB site
Description: structural characterisation of an engineered tandem repeat contrasts the importance of context and sequence in protein folding
Deposited on 1999-05-11, released 1999-05-24
The last revision prior to the SCOP 1.69 freeze date was dated 1999-05-24, with a file datestamp of 1999-05-23.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.17
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d261la_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >261lA (A:)
    mnifemlrideglrlkiykdtegyytigighlltkspsinaakseldkainaakseldka
    igrntngvitkdeaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmget
    gvagftnslrmlqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk