PDB entry 260l

View 260l on RCSB PDB site
Description: an adaptable metal-binding site engineered into t4 lysozyme
Deposited on 1999-03-01, released 2000-09-11
The last revision prior to the SCOP 1.55 freeze date was dated 2000-09-11, with a file datestamp of 2000-09-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.19
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d260la_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >260lA (A:)
    mnifemlrideglrlkiykdhegyytigighlltkspslnaakseldkaigrntngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
    lqqkrwdeaavnlaksrwynqhpnrakrvittfrtgtwdayk