PDB entry 256b

View 256b on RCSB PDB site
Description: improvement of the 2.5 angstroms resolution model of cytochrome b562 by redetermining the primary structure and using molecular graphics
Deposited on 1990-01-16, released 1991-01-15
The last revision prior to the SCOP 1.55 freeze date was dated 1992-07-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.4 Å
R-factor: 0.164
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d256ba_
  • Chain 'B':
    Domains in SCOP 1.55: d256bb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >256bA (A:)
adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemkd
frhgfdilvgqiddalklanegkvkeaqaaaeqlkttrnayhqkyr

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >256bB (B:)
adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemkd
frhgfdilvgqiddalklanegkvkeaqaaaeqlkttrnayhqkyr