PDB entry 249l

View 249l on RCSB PDB site
Description: the response of t4 lysozyme to large-to-small substitutions within the core and its relation to the hydrophobic effect
Deposited on 1997-10-22, released 1998-03-18
The last revision prior to the SCOP 1.55 freeze date was dated 1998-03-18, with a file datestamp of 1998-03-18.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.15
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d249l__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >249l_ (-)
    mnifemlrideglrlkiykdtegyytagighlltkspslnaakseldkaigrntngvatk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
    lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl