PDB entry 207l

View 207l on RCSB PDB site
Description: mutant human lysozyme c77a
Class: hydrolase/hydrolase inhibitor
Keywords: hydrolase (o-glycosyl)-cys), mutant human lysozyme, hydrolase-hydrolase inhibitor complex
Deposited on 1996-03-26, released 1996-10-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.161
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00695 (0-129)
      • engineered (76)
    Domains in SCOPe 2.06: d207la_
  • Heterogens: SC2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >207lA (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnaahlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv