PDB entry 1zzz

View 1zzz on RCSB PDB site
Description: Trypsin inhibitors with rigid tripeptidyl aldehydes
Class: hydrolase/hydrolase inhibitor
Keywords: SERINE PROTEASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 1998-06-02, released 1999-06-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.157
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1zzza_
  • Heterogens: 0IV, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zzzA (A:)
    lgaavafpvddddkivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgi
    qvrlgedninvvegneqfisasksivhpsynsntlnndimliklksaaslnsrvasislp
    tscasagtqclisgwgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyl
    eggkdscqgdsggpvvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zzzA (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn