PDB entry 1zzl

View 1zzl on RCSB PDB site
Description: Crystal structure of P38 with triazolopyridine
Class: transferase
Keywords: Phosphorylation,Serine/threonine-protein kinase, Transferase
Deposited on 2005-06-14, released 2005-09-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.223
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK14, CSBP, CSBP1, CSBP2, MXI2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1zzla_
  • Heterogens: TZY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zzlA (A:)
    erptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsii
    hakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqklt
    ddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgyv
    atrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpg
    aellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqal
    ahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppld