PDB entry 1zzk

View 1zzk on RCSB PDB site
Description: Crystal Structure of the third KH domain of hnRNP K at 0.95A resolution
Class: DNA binding protein
Keywords: KH domian, alpha-beta fold, DNA BINDING PROTEIN
Deposited on 2005-06-14, released 2005-08-09
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 0.95 Å
R-factor: 0.124
AEROSPACI score: 1.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heterogeneous nuclear ribonucleoprotein K
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61978 (3-81)
      • cloning artifact (2)
    Domains in SCOPe 2.03: d1zzka_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1zzkA (A:)
gamgpiittqvtipkdlagsiigkggqrikqirhesgasikideplegsedriititgtq
dqiqnaqyllqnsvkqysgkff

    Sequence, based on observed residues (ATOM records): (download) 
    >1zzkA (A:)
mgpiittqvtipkdlagsiigkggqrikqirhesgasikideplegsedriititgtqdq
iqnaqyllqnsvkqysgkff