PDB entry 1zze

View 1zze on RCSB PDB site
Description: X-ray Structure of NADPH-dependent Carbonyl Reductase from Sporobolomyces salmonicolor
Class: oxidoreductase
Keywords: Rosmann fold, OXIDOREDUCTASE
Deposited on 2005-06-14, released 2005-09-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.193
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aldehyde reductase II
    Species: Sporidiobolus salmonicolor [TaxId:5005]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1zzea_
  • Chain 'B':
    Compound: Aldehyde reductase II
    Species: Sporidiobolus salmonicolor [TaxId:5005]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1zzeb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zzeA (A:)
    akidnavlpegslvlvtgangfvashvveqllehgykvrgtarsasklanlqkrwdakyp
    grfetavvedmlkqgaydevikgaagvahiasvvsfsnkydevvtpaiggtlnalraaaa
    tpsvkrfvltsstvsalipkpnvegiyldekswnlesidkaktlpesdpqkslwvyaask
    teaelaawkfmdenkphftlnavlpnytigtifdpetqsgstsgwmmslfngevspalal
    mppqyyvsavdigllhlgclvlpqierrrvygtagtfdwntvlatfrklypsktfpadfp
    dqgqdlskfdtapsleilkslgrpgwrsieesikdlvgseta
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zzeB (B:)
    akidnavlpegslvlvtgangfvashvveqllehgykvrgtarsasklanlqkrwdakyp
    grfetavvedmlkqgaydevikgaagvahiasvvsfsnkydevvtpaiggtlnalraaaa
    tpsvkrfvltsstvsalipkpnvegiyldekswnlesidkaktlpesdpqkslwvyaask
    teaelaawkfmdenkphftlnavlpnytigtifdpetqsgstsgwmmslfngevspalal
    mppqyyvsavdigllhlgclvlpqierrrvygtagtfdwntvlatfrklypsktfpadfp
    dqgqdlskfdtapsleilkslgrpgwrsieesikdlvgseta