PDB entry 1zzb

View 1zzb on RCSB PDB site
Description: Crystal Structure of CoII HppE in Complex with Substrate
Class: oxidoreductase
Keywords: Mononuclear iron enzyme, Cupin, holo-HppE
Deposited on 2005-06-13, released 2005-07-26
The last revision prior to the SCOP 1.73 freeze date was dated 2005-11-22, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.238
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hydroxypropylphosphonic Acid Epoxidase
    Species: Streptomyces wedmorensis
    Gene: fom4
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1zzba1, d1zzba2
  • Chain 'B':
    Compound: Hydroxypropylphosphonic Acid Epoxidase
    Species: Streptomyces wedmorensis
    Gene: fom4
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1zzbb1, d1zzbb2
  • Heterogens: CO, S0H, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zzbA (A:)
    msntktastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgria
    hvlgtsigaltppagndlddgviiqmpderpilkgvrdnvdyyvynclvrtkrapslvpl
    vvdvltdnpddakfnsghagneflfvlegeihmkwgdkenpkeallptgasmfveehvph
    aftaakgtgsakliavnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zzbA (A:)
    tastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvlgt
    sigaltppagndlddgviiqmpderdyyvynclvrtkrapslvplvvdvltdnpddakfn
    sghagneflfvlegeihmkwgdkenpkeallptgasmfveehvphaftaakgsakliavn
    f
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zzbB (B:)
    msntktastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgria
    hvlgtsigaltppagndlddgviiqmpderpilkgvrdnvdyyvynclvrtkrapslvpl
    vvdvltdnpddakfnsghagneflfvlegeihmkwgdkenpkeallptgasmfveehvph
    aftaakgtgsakliavnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zzbB (B:)
    tastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvlgt
    sigaltppagndlddgviiqmpderpilkgvrdnvdyyvynclvrtkrapslvplvvdvl
    tdnpddakfnsghagneflfvlegeihmkwgdkenpkeallptgasmfveehvphaftaa
    kgtgsakliavnf