PDB entry 1zz9

View 1zz9 on RCSB PDB site
Description: Crystal Structure of FeII HppE
Class: oxidoreductase
Keywords: Mononuclear iron enzyme, Cupin, holo-HppE, OXIDOREDUCTASE
Deposited on 2005-06-13, released 2005-07-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.249
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hydroxypropylphosphonic Acid Epoxidase
    Species: STREPTOMYCES WEDMORENSIS [TaxId:43759]
    Gene: fom4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1zz9a1, d1zz9a2
  • Chain 'B':
    Compound: Hydroxypropylphosphonic Acid Epoxidase
    Species: STREPTOMYCES WEDMORENSIS [TaxId:43759]
    Gene: fom4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1zz9b1, d1zz9b2
  • Chain 'C':
    Compound: Hydroxypropylphosphonic Acid Epoxidase
    Species: STREPTOMYCES WEDMORENSIS [TaxId:43759]
    Gene: fom4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1zz9c1, d1zz9c2
  • Heterogens: FE2, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zz9A (A:)
    msntktastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgria
    hvlgtsigaltppagndlddgviiqmpderpilkgvrdnvdyyvynclvrtkrapslvpl
    vvdvltdnpddakfnsghagneflfvlegeihmkwgdkenpkeallptgasmfveehvph
    aftaakgtgsakliavnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zz9A (A:)
    tastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvlgt
    sigaltppagndlddgviiqmpderpilkgvrdnvdyyvynclvrtkrapslvplvvdvl
    tdnpddakfnsghagneflfvlegeihmkwgdkepkeallptgasmfveehvphaftaak
    gtgsakliavnf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zz9B (B:)
    msntktastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgria
    hvlgtsigaltppagndlddgviiqmpderpilkgvrdnvdyyvynclvrtkrapslvpl
    vvdvltdnpddakfnsghagneflfvlegeihmkwgdkenpkeallptgasmfveehvph
    aftaakgtgsakliavnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zz9B (B:)
    tastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvlgt
    sigaltppagndlddgviiqmpderpilkgvrdnvdyyvynclvrtkrapslvplvvdvl
    tdnpddakfnsghagneflfvlegeihmkwgdkenpkeallptgasmfveehvphaftaa
    kgtgsakliavnf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1zz9C (C:)
    msntktastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgria
    hvlgtsigaltppagndlddgviiqmpderpilkgvrdnvdyyvynclvrtkrapslvpl
    vvdvltdnpddakfnsghagneflfvlegeihmkwgdkenpkeallptgasmfveehvph
    aftaakgtgsakliavnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zz9C (C:)
    tastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvlgt
    sigaltppagndlddgviiqmpderpilkgvvdyyvynclvrtkrapslvplvvdvltdn
    pddakfnsghagneflfvlegeihmkwgdkenpkeallptgasmfveehvphaftaakgt
    gsakliavnf