PDB entry 1zz7

View 1zz7 on RCSB PDB site
Description: Crystal Structure of FeII HppE in Complex with Substrate form 1
Class: oxidoreductase
Keywords: Substrate-Enzyme Complex, Cupin, Mononuclear Iron Enzyme
Deposited on 2005-06-13, released 2005-07-26
The last revision prior to the SCOP 1.75 freeze date was dated 2005-11-22, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.244
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hydroxyprophylphosphonic Acid Epoxidase
    Species: Streptomyces wedmorensis
    Gene: fom4
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1zz7a1, d1zz7a2
  • Chain 'B':
    Compound: Hydroxyprophylphosphonic Acid Epoxidase
    Species: Streptomyces wedmorensis
    Gene: fom4
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1zz7b1, d1zz7b2
  • Heterogens: FE2, S0H, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zz7A (A:)
    msntktastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgria
    hvlgtsigaltppagndlddgviiqmpderpilkgvrdnvdyyvynclvrtkrapslvpl
    vvdvltdnpddakfnsghagneflfvlegeihmkwgdkenpkeallptgasmfveehvph
    aftaakgtgsakliavnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zz7A (A:)
    astgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvlgts
    igaltppagndlddgviiqmpyyvynclvrtkrapslvplvvdvltdnpddakfnsghag
    neflfvlegeihmkwgdkenpkeallptgasmfveehvphaftaakgtgsakliavnf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zz7B (B:)
    msntktastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgria
    hvlgtsigaltppagndlddgviiqmpderpilkgvrdnvdyyvynclvrtkrapslvpl
    vvdvltdnpddakfnsghagneflfvlegeihmkwgdkenpkeallptgasmfveehvph
    aftaakgtgsakliavnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zz7B (B:)
    astgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvlgts
    igaltppagndlddgviiqmpyvynclvrtkrapslvplvvdvltdnpddakfnsghagn
    eflfvlegeihmkwgnpkeallptgasmfveehvphaftaakgtgsakliavnf