PDB entry 1zz6

View 1zz6 on RCSB PDB site
Description: Crystal Structure of Apo-HppE
Class: oxidoreductase
Keywords: Mononuclear Iron Enzyme, Apoprotein, Cupin, OXIDOREDUCTASE
Deposited on 2005-06-13, released 2005-07-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.278
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hydroxypropylphosphonic Acid Epoxidase
    Species: STREPTOMYCES WEDMORENSIS [TaxId:43759]
    Gene: fom4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1zz6a1, d1zz6a2
  • Chain 'B':
    Compound: Hydroxypropylphosphonic Acid Epoxidase
    Species: STREPTOMYCES WEDMORENSIS [TaxId:43759]
    Gene: fom4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1zz6b1, d1zz6b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zz6A (A:)
    msntktastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgria
    hvlgtsigaltppagndlddgviiqmpderpilkgvrdnvdyyvynclvrtkrapslvpl
    vvdvltdnpddakfnsghagneflfvlegeihmkwgdkenpkeallptgasmfveehvph
    aftaakgtgsakliavnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zz6A (A:)
    tastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvlgt
    sigaltppagndlddgviiqmpderpilkgvyyvynclvrtkrapslvplvvdvltdnpd
    dakfnsgneflfvlegeihmkwgdkeallptgasmfveehvphaftaakgtgsakliavn
    f
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zz6B (B:)
    msntktastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgria
    hvlgtsigaltppagndlddgviiqmpderpilkgvrdnvdyyvynclvrtkrapslvpl
    vvdvltdnpddakfnsghagneflfvlegeihmkwgdkenpkeallptgasmfveehvph
    aftaakgtgsakliavnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zz6B (B:)
    tastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvlgt
    sigaltppagndlddgviiqmpderpilkgvrdyyvynclvrtkrapslvplvvdvltdn
    pddakfnsneflfvlegeihmkwgdkkeallptgasmfveehvphaftaakgtgsaklia
    vnf