PDB entry 1zyw

View 1zyw on RCSB PDB site
Description: Crystal Structure Of Mutant K8DP9SR58KP60G Of Scorpion alpha-Like Neurotoxin Bmk M1 From Buthus Martensii Karsch
Class: toxin
Keywords: scorpion alpha-like toxin, bmk m1, mutant, mammal/insect selectivity
Deposited on 2005-06-13, released 2006-05-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.143
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Alpha-like neurotoxin BmK-I
  Species: Mesobuthus martensii [TaxId:34649]
  Gene: BmK M1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P45697 (2-65)
    • cloning artifact (0-1)
    • engineered (9-10)
    • engineered (59)
    • engineered (61)
  Domains in SCOPe 2.06: d1zywa1, d1zywa2
• Heterogens: SO4, ACT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1zywA (A:)
  nsvrdayiadshncvyecarneycndlctkngaksgycqwvgkygngcwcielpdnvpik
  vggkch