PDB entry 1zys

View 1zys on RCSB PDB site
Description: Co-crystal structure of Checkpoint Kinase Chk1 with a pyrrolo-pyridine inhibitor
Class: signaling protein, transferase
Keywords: Chk1; Crystal structure, SIGNALING PROTEIN, TRANSFERASE
Deposited on 2005-06-10, released 2006-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase Chk1
    Species: Homo sapiens [TaxId:9606]
    Gene: CHEK1, CHK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14757 (Start-272)
      • conflict (59)
    Domains in SCOPe 2.07: d1zysa_
  • Chain 'B':
    Compound: pentapeptide fragment
    Species:
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1ZYS (0-4)
  • Heterogens: SO4, 199, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zysA (A:)
    mavpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicina
    mlnhenvvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvy
    lhgigithrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellk
    rrefhaepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsapla
    llhkilvenpsaritipdikkdrwynkplkkga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zysA (A:)
    vpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicinaml
    nhenvvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvylh
    gigithrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkrr
    efhaepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplall
    hkilvenpsaritipdikkdrwynkplkkga
    

  • Chain 'B':
    No sequence available.