PDB entry 1zyl

View 1zyl on RCSB PDB site
Description: Crystal Structure of Hypothetical Protein YihE from Escherichia coli
Class: structural genomics, unknown function
Keywords: hypothetical protein, putative protein kinase, Structural Genomics, PSI, Protein Structure Initiative, Montreal-Kingston Bacterial Structural Genomics Initiative, BSGI, UNKNOWN FUNCTION
Deposited on 2005-06-10, released 2006-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.215
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein yihE
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zyla1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zylA (A:)
    mnnsaftfqtlhpdtimdalfehgirvdsgltplnsyenrvyqfqdedrrrfvvkfyrpe
    rwtadqileehqfalqlvndevpvaapvafngqtllnhqgfyfavfpsvggrqfeadnid
    qmeavgrylgrmhqtgrkqlfihrptiglneylieprklfedatlipsglkaaflkatde
    liaavtahwredftvlrlhgdchagnilwrdgpmfvdlddarngpavqdlwmllngdkae
    qrmqletiieayeefsefdtaeiglieplramrlvyylawlmrrwadpafpknfpwltge
    dywlrqtatfieqakvlqepplqltpmy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zylA (A:)
    saftfqtlhpdtimdalfehgirvdsgltplnsyenrvyqfqdedrrrfvvkfyrperwt
    adqileehqfalqlvndevpvaapvafngqtllnhqgfyfavfpsvggrqfeadnidqme
    avgrylgrmhqtgrkqlfihrptiglneylieprklfedatlipsglkaaflkatdelia
    avtahwredftvlrlhgdchagnilwrdgpmfvdlddarngpavqdlwmllngdkaeqrm
    qletiieayeefsefdtaeiglieplramrlvyylawlmrrwadpafpknfpwltgedyw
    lrqtatfieqakvlqepplqltpmy