PDB entry 1zyk

View 1zyk on RCSB PDB site
Description: Anthranilate Phosphoribosyltransferase in complex with PRPP, anthranilate and magnesium
Class: transferase
Keywords: Anthranilate Phosphoribosyltransferase, PRPP, anthranilate, TrpD
Deposited on 2005-06-10, released 2006-05-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.207
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Anthranilate phosphoribosyltransferase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1zyka1, d1zyka2
  • Chain 'B':
    Compound: Anthranilate phosphoribosyltransferase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1zykb1, d1zykb2
  • Chain 'C':
    Compound: Anthranilate phosphoribosyltransferase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1zykc1, d1zykc2
  • Chain 'D':
    Compound: Anthranilate phosphoribosyltransferase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1zykd1, d1zykd2
  • Heterogens: MG, PRP, BE2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zykA (A:)
    mnineilkklinksdleineaeelakaiirgevpeilvsailvalrmkgeskneivgfar
    amrelaikidvpnaidtagtggdglgtvnvstasaillslvnpvakhgnravsgksgsad
    vlealgyniivpperakelvnktnfvflfaqyyhpamknvanvrktlgirtifnilgplt
    npanakyqlmgvfskdhldllsksayeldfnkiilvygepgidevspigntfmkivskrg
    ieevklnvtdfgispipieklivnsaedsaikivraflgkdehvaefikintavalfald
    rvgdfregyeyadhlieksldklneiismngdvtklktivvkssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zykA (A:)
    mnineilkklinksdleineaeelakaiirgevpeilvsailvalrmkgeskneivgfar
    amrelaikidvpnaidtagtggdglgtvnvstasaillslvnpvakhgnravsgksgsad
    vlealgyniivpperakelvnktnfvflfaqyyhpamknvanvrktlgirtifnilgplt
    npanakyqlmgvfskdhldllsksayeldfnkiilvygepgidevspigntfmkivskrg
    ieevklnvtdfgispipieklivnsaedsaikivraflgkdehvaefikintavalfald
    rvgdfregyeyadhlieksldklneiismngdvtklktivvkss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zykB (B:)
    mnineilkklinksdleineaeelakaiirgevpeilvsailvalrmkgeskneivgfar
    amrelaikidvpnaidtagtggdglgtvnvstasaillslvnpvakhgnravsgksgsad
    vlealgyniivpperakelvnktnfvflfaqyyhpamknvanvrktlgirtifnilgplt
    npanakyqlmgvfskdhldllsksayeldfnkiilvygepgidevspigntfmkivskrg
    ieevklnvtdfgispipieklivnsaedsaikivraflgkdehvaefikintavalfald
    rvgdfregyeyadhlieksldklneiismngdvtklktivvkssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zykB (B:)
    mnineilkklinksdleineaeelakaiirgevpeilvsailvalrmkgeskneivgfar
    amrelaikidvpnaidtagtggdglgtvnvstasaillslvnpvakhgnravsgksgsad
    vlealgyniivpperakelvnktnfvflfaqyyhpamknvanvrktlgirtifnilgplt
    npanakyqlmgvfskdhldllsksayeldfnkiilvygepgidevspigntfmkivskrg
    ieevklnvtdfgispipieklivnsaedsaikivraflgkdehvaefikintavalfald
    rvgdfregyeyadhlieksldklneiismngdvtklktivvkss
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1zykC (C:)
    mnineilkklinksdleineaeelakaiirgevpeilvsailvalrmkgeskneivgfar
    amrelaikidvpnaidtagtggdglgtvnvstasaillslvnpvakhgnravsgksgsad
    vlealgyniivpperakelvnktnfvflfaqyyhpamknvanvrktlgirtifnilgplt
    npanakyqlmgvfskdhldllsksayeldfnkiilvygepgidevspigntfmkivskrg
    ieevklnvtdfgispipieklivnsaedsaikivraflgkdehvaefikintavalfald
    rvgdfregyeyadhlieksldklneiismngdvtklktivvkssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zykC (C:)
    mnineilkklinksdleineaeelakaiirgevpeilvsailvalrmkgeskneivgfar
    amrelaikidvpnaidtagtggdglgtvnvstasaillslvnpvakhgnravsgksgsad
    vlealgyniivpperakelvnktnfvflfaqyyhpamknvanvrktlgirtifnilgplt
    npanakyqlmgvfskdhldllsksayeldfnkiilvygepgidevspigntfmkivskrg
    ieevklnvtdfgispipieklivnsaedsaikivraflgkdehvaefikintavalfald
    rvgdfregyeyadhlieksldklneiismngdvtklktivvks
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1zykD (D:)
    mnineilkklinksdleineaeelakaiirgevpeilvsailvalrmkgeskneivgfar
    amrelaikidvpnaidtagtggdglgtvnvstasaillslvnpvakhgnravsgksgsad
    vlealgyniivpperakelvnktnfvflfaqyyhpamknvanvrktlgirtifnilgplt
    npanakyqlmgvfskdhldllsksayeldfnkiilvygepgidevspigntfmkivskrg
    ieevklnvtdfgispipieklivnsaedsaikivraflgkdehvaefikintavalfald
    rvgdfregyeyadhlieksldklneiismngdvtklktivvkssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zykD (D:)
    mnineilkklinksdleineaeelakaiirgevpeilvsailvalrmkgeskneivgfar
    amrelaikidvpnaidtagtggdglgtvnvstasaillslvnpvakhgnravsgksgsad
    vlealgyniivpperakelvnktnfvflfaqyyhpamknvanvrktlgirtifnilgplt
    npanakyqlmgvfskdhldllsksayeldfnkiilvygepgidevspigntfmkivskrg
    ieevklnvtdfgispipieklivnsaedsaikivraflgkdehvaefikintavalfald
    rvgdfregyeyadhlieksldklneiismngdvtklktivvkss