PDB entry 1zye

View 1zye on RCSB PDB site
Description: Crystal structure analysis of Bovine Mitochondrial Peroxiredoxin III
Class: oxidoreductase
Keywords: catenane, dodecamer, peroxiredoxin, OXIDOREDUCTASE
Deposited on 2005-06-10, released 2005-09-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-09-09, with a file datestamp of 2020-09-04.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thioredoxin-dependent peroxide reductase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zyea1
  • Chain 'B':
    Compound: Thioredoxin-dependent peroxide reductase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zyeb1
  • Chain 'C':
    Compound: Thioredoxin-dependent peroxide reductase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zyec1
  • Chain 'D':
    Compound: Thioredoxin-dependent peroxide reductase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zyed1
  • Chain 'E':
    Compound: Thioredoxin-dependent peroxide reductase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zyee1
  • Chain 'F':
    Compound: Thioredoxin-dependent peroxide reductase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zyef1
  • Chain 'G':
    Compound: Thioredoxin-dependent peroxide reductase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zyeg1
  • Chain 'H':
    Compound: Thioredoxin-dependent peroxide reductase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zyeh1
  • Chain 'I':
    Compound: Thioredoxin-dependent peroxide reductase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zyei1
  • Chain 'J':
    Compound: Thioredoxin-dependent peroxide reductase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zyej1
  • Chain 'K':
    Compound: Thioredoxin-dependent peroxide reductase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zyek1
  • Chain 'L':
    Compound: Thioredoxin-dependent peroxide reductase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zyel1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zyeA (A:)
    mgsshhhhhhssglvprgshmledpapavtqhapyfkgtavvsgefkeislddfkgkylv
    lffypldftfvcpteiiafsdkasefhdvncevvavsvdshfshlawintprkngglghm
    niallsdltkqisrdygvllegpglalrglfiidpngvikhlsvndlpvgrsveetlrlv
    kafqfveahgevspanwtpesptikphptasreyfekvnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zyeA (A:)
    pavtqhapyfkgtavvsgefkeislddfkgkylvlffypldftfvcpteiiafsdkasef
    hdvncevvavsvdshfshlawintprkngglghmniallsdltkqisrdygvllegpgla
    lrglfiidpngvikhlsvndlpvgrsveetlrlvkafqfvea
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zyeB (B:)
    mgsshhhhhhssglvprgshmledpapavtqhapyfkgtavvsgefkeislddfkgkylv
    lffypldftfvcpteiiafsdkasefhdvncevvavsvdshfshlawintprkngglghm
    niallsdltkqisrdygvllegpglalrglfiidpngvikhlsvndlpvgrsveetlrlv
    kafqfveahgevspanwtpesptikphptasreyfekvnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zyeB (B:)
    pavtqhapyfkgtavvsgefkeislddfkgkylvlffypldftfvcpteiiafsdkasef
    hdvncevvavsvdshfshlawintprkngglghmniallsdltkqisrdygvllegpgla
    lrglfiidpngvikhlsvndlpvgrsveetlrlvkafqfvea
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1zyeC (C:)
    mgsshhhhhhssglvprgshmledpapavtqhapyfkgtavvsgefkeislddfkgkylv
    lffypldftfvcpteiiafsdkasefhdvncevvavsvdshfshlawintprkngglghm
    niallsdltkqisrdygvllegpglalrglfiidpngvikhlsvndlpvgrsveetlrlv
    kafqfveahgevspanwtpesptikphptasreyfekvnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zyeC (C:)
    pavtqhapyfkgtavvsgefkeislddfkgkylvlffypldftfvcpteiiafsdkasef
    hdvncevvavsvdshfshlawintprkngglghmniallsdltkqisrdygvllegpgla
    lrglfiidpngvikhlsvndlpvgrsveetlrlvkafqfvea
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1zyeD (D:)
    mgsshhhhhhssglvprgshmledpapavtqhapyfkgtavvsgefkeislddfkgkylv
    lffypldftfvcpteiiafsdkasefhdvncevvavsvdshfshlawintprkngglghm
    niallsdltkqisrdygvllegpglalrglfiidpngvikhlsvndlpvgrsveetlrlv
    kafqfveahgevspanwtpesptikphptasreyfekvnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zyeD (D:)
    pavtqhapyfkgtavvsgefkeislddfkgkylvlffypldftfvcpteiiafsdkasef
    hdvncevvavsvdshfshlawintprkngglghmniallsdltkqisrdygvllegpgla
    lrglfiidpngvikhlsvndlpvgrsveetlrlvkafqfvea
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1zyeE (E:)
    mgsshhhhhhssglvprgshmledpapavtqhapyfkgtavvsgefkeislddfkgkylv
    lffypldftfvcpteiiafsdkasefhdvncevvavsvdshfshlawintprkngglghm
    niallsdltkqisrdygvllegpglalrglfiidpngvikhlsvndlpvgrsveetlrlv
    kafqfveahgevspanwtpesptikphptasreyfekvnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zyeE (E:)
    pavtqhapyfkgtavvsgefkeislddfkgkylvlffypldftfvcpteiiafsdkasef
    hdvncevvavsvdshfshlawintprkngglghmniallsdltkqisrdygvllegpgla
    lrglfiidpngvikhlsvndlpvgrsveetlrlvkafqfvea
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1zyeF (F:)
    mgsshhhhhhssglvprgshmledpapavtqhapyfkgtavvsgefkeislddfkgkylv
    lffypldftfvcpteiiafsdkasefhdvncevvavsvdshfshlawintprkngglghm
    niallsdltkqisrdygvllegpglalrglfiidpngvikhlsvndlpvgrsveetlrlv
    kafqfveahgevspanwtpesptikphptasreyfekvnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zyeF (F:)
    pavtqhapyfkgtavvsgefkeislddfkgkylvlffypldftfvcpteiiafsdkasef
    hdvncevvavsvdshfshlawintprkngglghmniallsdltkqisrdygvllegpgla
    lrglfiidpngvikhlsvndlpvgrsveetlrlvkafqfvea
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1zyeG (G:)
    mgsshhhhhhssglvprgshmledpapavtqhapyfkgtavvsgefkeislddfkgkylv
    lffypldftfvcpteiiafsdkasefhdvncevvavsvdshfshlawintprkngglghm
    niallsdltkqisrdygvllegpglalrglfiidpngvikhlsvndlpvgrsveetlrlv
    kafqfveahgevspanwtpesptikphptasreyfekvnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zyeG (G:)
    pavtqhapyfkgtavvsgefkeislddfkgkylvlffypldftfvcpteiiafsdkasef
    hdvncevvavsvdshfshlawintprkngglghmniallsdltkqisrdygvllegpgla
    lrglfiidpngvikhlsvndlpvgrsveetlrlvkafqfvea
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1zyeH (H:)
    mgsshhhhhhssglvprgshmledpapavtqhapyfkgtavvsgefkeislddfkgkylv
    lffypldftfvcpteiiafsdkasefhdvncevvavsvdshfshlawintprkngglghm
    niallsdltkqisrdygvllegpglalrglfiidpngvikhlsvndlpvgrsveetlrlv
    kafqfveahgevspanwtpesptikphptasreyfekvnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zyeH (H:)
    pavtqhapyfkgtavvsgefkeislddfkgkylvlffypldftfvcpteiiafsdkasef
    hdvncevvavsvdshfshlawintprkngglghmniallsdltkqisrdygvllegpgla
    lrglfiidpngvikhlsvndlpvgrsveetlrlvkafqfvea
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1zyeI (I:)
    mgsshhhhhhssglvprgshmledpapavtqhapyfkgtavvsgefkeislddfkgkylv
    lffypldftfvcpteiiafsdkasefhdvncevvavsvdshfshlawintprkngglghm
    niallsdltkqisrdygvllegpglalrglfiidpngvikhlsvndlpvgrsveetlrlv
    kafqfveahgevspanwtpesptikphptasreyfekvnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zyeI (I:)
    pavtqhapyfkgtavvsgefkeislddfkgkylvlffypldftfvcpteiiafsdkasef
    hdvncevvavsvdshfshlawintprkngglghmniallsdltkqisrdygvllegpgla
    lrglfiidpngvikhlsvndlpvgrsveetlrlvkafqfvea
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1zyeJ (J:)
    mgsshhhhhhssglvprgshmledpapavtqhapyfkgtavvsgefkeislddfkgkylv
    lffypldftfvcpteiiafsdkasefhdvncevvavsvdshfshlawintprkngglghm
    niallsdltkqisrdygvllegpglalrglfiidpngvikhlsvndlpvgrsveetlrlv
    kafqfveahgevspanwtpesptikphptasreyfekvnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zyeJ (J:)
    pavtqhapyfkgtavvsgefkeislddfkgkylvlffypldftfvcpteiiafsdkasef
    hdvncevvavsvdshfshlawintprkngglghmniallsdltkqisrdygvllegpgla
    lrglfiidpngvikhlsvndlpvgrsveetlrlvkafqfvea
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1zyeK (K:)
    mgsshhhhhhssglvprgshmledpapavtqhapyfkgtavvsgefkeislddfkgkylv
    lffypldftfvcpteiiafsdkasefhdvncevvavsvdshfshlawintprkngglghm
    niallsdltkqisrdygvllegpglalrglfiidpngvikhlsvndlpvgrsveetlrlv
    kafqfveahgevspanwtpesptikphptasreyfekvnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zyeK (K:)
    pavtqhapyfkgtavvsgefkeislddfkgkylvlffypldftfvcpteiiafsdkasef
    hdvncevvavsvdshfshlawintprkngglghmniallsdltkqisrdygvllegpgla
    lrglfiidpngvikhlsvndlpvgrsveetlrlvkafqfvea
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1zyeL (L:)
    mgsshhhhhhssglvprgshmledpapavtqhapyfkgtavvsgefkeislddfkgkylv
    lffypldftfvcpteiiafsdkasefhdvncevvavsvdshfshlawintprkngglghm
    niallsdltkqisrdygvllegpglalrglfiidpngvikhlsvndlpvgrsveetlrlv
    kafqfveahgevspanwtpesptikphptasreyfekvnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zyeL (L:)
    pavtqhapyfkgtavvsgefkeislddfkgkylvlffypldftfvcpteiiafsdkasef
    hdvncevvavsvdshfshlawintprkngglghmniallsdltkqisrdygvllegpgla
    lrglfiidpngvikhlsvndlpvgrsveetlrlvkafqfvea