PDB entry 1zy9

View 1zy9 on RCSB PDB site
Description: Crystal structure of Alpha-galactosidase (EC 3.2.1.22) (Melibiase) (tm1192) from Thermotoga maritima at 2.34 A resolution
Class: hydrolase
Keywords: tm1192, Alpha-galactosidase (EC 3.2.1.22) (Melibiase), Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI
Deposited on 2005-06-09, released 2005-07-12
The last revision prior to the SCOP 1.73 freeze date was dated 2005-07-12, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.34 Å
R-factor: 0.162
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-galactosidase
    Species: Thermotoga maritima
    Gene: tm1192
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33835 (12-End)
      • leader sequence (11)
      • modified residue (12)
      • modified residue (184)
      • modified residue (254)
      • modified residue (297)
      • modified residue (330)
      • modified residue (393)
      • modified residue (428)
      • modified residue (467)
      • modified residue (502)
    Domains in SCOP 1.73: d1zy9a1, d1zy9a2
  • Heterogens: EDO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zy9A (A:)
    mgsdkihhhhhhmeifgktfregrfvlkeknftvefavekihlgwkisgrvkgspgrlev
    lrtkapekvlvnnwqswgpcrvvdafsfkppeidpnwrytasvvpdvlernlqsdyfvae
    egkvygflsskiahpffavedgelvayleyfdvefddfvpleplvvledpntplllekya
    elvgmennarvpkhtptgwcswyhyfldltweetlknlklaknfpfevfqiddayekdig
    dwlvtrgdfpsveemakviaengfipgiwtapfsvsetsdvfnehpdwvvkengepkmay
    rnwnkkiyaldlskdevlnwlfdlfsslrkmgyryfkidflfagavpgerkknitpiqaf
    rkgietirkavgedsfilgcgspllpavgcvdgmrigpdtapfwgehiedngapaarwal
    rnaitryfmhdrfwlndpdclilreektdltqkekelysytcgvldnmiiesddlslvrd
    hgkkvlketlellggrprvqnimsedlryeivssgtlsgnvkivvdlnsreyhlekegks
    slkkrvvkredgrnfyfyeegere
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zy9A (A:)
    hmeifgktfregrfvlkeknftvefavekihlgwkisgrvkgspgrlevlrtkapekvlv
    nnwqswgpcrvvdafsfkppeidpnwrytasvvpdvlernlqsdyfvaeegkvygflssk
    iahpffavedgelvayleyfdvefddfvpleplvvledpntplllekyaelvgmennarv
    pkhtptgwcswyhyfldltweetlknlklaknfpfevfqiddayekdigdwlvtrgdfps
    veemakviaengfipgiwtapfsvsetsdvfnehpdwvvkengepkmayrnwnkkiyald
    lskdevlnwlfdlfsslrkmgyryfkidflfagavpgerkknitpiqafrkgietirkav
    gedsfilgcgspllpavgcvdgmrigpdtapfwgehiedngapaarwalrnaitryfmhd
    rfwlndpdclilreektdltqkekelysytcgvldnmiiesddlslvrdhgkkvlketle
    llggrprvqnimsedlryeivssgtlsgnvkivvdlnsreyhleke