PDB entry 1zy3

View 1zy3 on RCSB PDB site
Description: Structural model of complex of Bcl-w protein with Bid BH3-peptide
Class: apoptosis
Keywords: Apoptosis, Bcl-w, BH3-peptide
Deposited on 2005-06-09, released 2006-02-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Apoptosis regulator Bcl-W
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92843 (0-169)
      • engineered (115)
    Domains in SCOPe 2.08: d1zy3a1
  • Chain 'B':
    Compound: BH3-peptide from BH3 interacting domain death agonist protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55957 (0-19)
      • engineered (2)

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zy3A (A:)
    atpasapdtralvadfvgyklrqkgyvcgagpgegpaadplhqamraagdefetrfrrtf
    sdlaaqlhvtpgsaqqrftqvsdelfqggpnwgrlvaffvfgaalcaesvnkemevlvgq
    vqewmvayletrladwihssggwaeftalygdgaleearrlregnwasvrlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zy3A (A:)
    atpasapdtralvadfvgyklrqkgyvcgagpgegpaadplhqamraagdefetrfrrtf
    sdlaaqlhvtpgsaqqrftqvsdelfqggpnwgrlvaffvfgaalcaesvnkemevlvgq
    vqewmvayletrladwihssggwaeftalygdgaleearrlregnwasvr
    

  • Chain 'B':
    No sequence available.