PDB entry 1zy2

View 1zy2 on RCSB PDB site
Description: Crystal structure of the phosphorylated receiver domain of the transcription regulator NtrC1 from Aquifex aeolicus
Class: transcription
Keywords: phosphorylated receiver domain, sigma-54 activator, two-component signaling, ntrc, transcription
Deposited on 2005-06-09, released 2005-08-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.03 Å
R-factor: 0.251
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcriptional regulator NtrC1
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: NTRC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67198 (0-135)
      • modified residue (50)
      • cloning artifact (136-139)
    Domains in SCOPe 2.06: d1zy2a1, d1zy2a2
  • Chain 'B':
    Compound: transcriptional regulator NtrC1
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: NTRC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67198 (0-End)
      • modified residue (50)
    Domains in SCOPe 2.06: d1zy2b_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zy2A (A:)
    mnvlvieddkvfrglleeylsmkgikvesaergkeaykllsekhfnvvlldlllpdvngl
    eilkwikerspetevivitghgtiktaveamkmgaydfltkpcmleeieltinkaiehrk
    lrkenellrrekdlkeklaaalehhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zy2A (A:)
    mnvlvieddkvfrglleeylsmkgikvesaergkeaykllsekhfnvvlldlllpdvngl
    eilkwikerspetevivitghgtiktaveamkmgaydfltkpcmleeieltinkaiehrk
    lrkenellrrekdlkeklaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zy2B (B:)
    mnvlvieddkvfrglleeylsmkgikvesaergkeaykllsekhfnvvlldlllpdvngl
    eilkwikerspetevivitghgtiktaveamkmgaydfltkpcmleeieltinkaiehrk
    lrkenellrrekdlkeklaaalehhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zy2B (B:)
    mnvlvieddkvfrglleeylsmkgikvesaergkeaykllsekhfnvvlldlllpdvngl
    eilkwikerspetevivitghgtiktaveamkmgaydfltkpcmleeieltinkaiehrk
    lrken