PDB entry 1zxu

View 1zxu on RCSB PDB site
Description: X-ray structure of protein from arabidopsis thaliana AT5G01750
Class: structural genomics, unknown function
Keywords: at5g01750, pfam pf01167, tulp, structural genomics, protein structure initiative, psi, center for eukaryotic structural genomics, cesg, unknown function
Deposited on 2005-06-08, released 2005-06-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: At5g01750 protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AT5G01750
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LZX1
      • modified residue (39)
      • modified residue (170)
    Domains in SCOPe 2.07: d1zxua1
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zxuA (A:)
    meqpyvyaypqgsgpsgaptpqaggvvvdpkycapypidmaivrkmmsltdgnfvitdvn
    gnllfkvkepvfglhdkrvlldgsgtpvvtlrekmvsmhdrwqvfrggstdqrdllytvk
    rssmlqlktkldvflghnkdekrcdfrvkgswlerscvvyagesdaivaqmhrkhtvqsv
    flgkdnfsvtvypnvdyafiaslvvilddvnredraa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zxuA (A:)
    ggvvvdpkycapypidmaivrkdgnfvitdvngnllfkvkepvfglhdkrvlldgsgtpv
    vtlredrwqvfrggstdqrdllytvkrtkldvflghnkdkrcdfrvkgswlerscvvyag
    esdaivaqmhrkgkdnfsvtvypnvdyafiaslvvilddvnr