PDB entry 1zxq

View 1zxq on RCSB PDB site
Description: the crystal structure of icam-2
Class: cell adhesion
Keywords: immunoglobulin fold, cell adhesion, glycoprotein, transmembrane, repeat, signal
Deposited on 1997-03-04, released 1997-09-04
The last revision prior to the SCOP 1.75 freeze date was dated 1997-09-04, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.226
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: intercellular adhesion molecule-2
    Species: HOMO SAPIENS
    Gene: ICAM-2
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1zxqa1, d1zxqa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1zxqA (A:)
kvfevhvrpkklavepkgslevncsttcnqpevggletslnkilldeqaqwkhylvsnis
hdtvlqchftcsgkqesmnsnvsvyqpprqviltlqptlvavgksftiecrvptveplds
ltlflfrgnetlhyetfgkaapapqeatatfnstadredghrnfsclavldlmsrggnif
hkhsapkmleiy