PDB entry 1zxq

View 1zxq on RCSB PDB site
Description: the crystal structure of icam-2
Deposited on 1997-03-04, released 1997-09-04
The last revision prior to the SCOP 1.55 freeze date was dated 1997-09-04, with a file datestamp of 1997-09-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.226
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zxq_ (-)
    kvfevhvrpkklavepkgslevncsttcnqpevggletslnkilldeqaqwkhylvsnis
    hdtvlqchftcsgkqesmnsnvsvyqpprqviltlqptlvavgksftiecrvptveplds
    ltlflfrgnetlhyetfgkaapapqeatatfnstadredghrnfsclavldlmsrggnif
    hkhsapkmleiy