PDB entry 1zxq

View 1zxq on RCSB PDB site
Description: the crystal structure of icam-2
Class: cell adhesion
Keywords: immunoglobulin fold, cell adhesion, glycoprotein, transmembrane
Deposited on 1997-03-04, released 1997-09-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-09.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: intercellular adhesion molecule-2
    Species: Homo sapiens [TaxId:9606]
    Gene: ICAM-2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zxqa1, d1zxqa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1zxqA (A:)
kvfevhvrpkklavepkgslevncsttcnqpevggletslnkilldeqaqwkhylvsnis
hdtvlqchftcsgkqesmnsnvsvyqpprqviltlqptlvavgksftiecrvptveplds
ltlflfrgnetlhyetfgkaapapqeatatfnstadredghrnfsclavldlmsrggnif
hkhsapkmleiy