PDB entry 1zxl

View 1zxl on RCSB PDB site
Description: Synthesis, Biological Activity, and X-Ray Crystal Structural Analysis of Diaryl Ether Inhibitors of Malarial Enoyl ACP Reductase. Part 1:4'-Substituted Triclosan Derivatives
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2005-06-08, released 2006-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.195
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enoyl-acyl carrier reductase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: PfENR
    Database cross-references and differences (RAF-indexed):
    • GB NP_703811 (0-End)
    Domains in SCOPe 2.07: d1zxla_
  • Chain 'B':
    Compound: enoyl-acyl carrier reductase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: PfENR
    Database cross-references and differences (RAF-indexed):
    • GB NP_703811 (0-End)
    Domains in SCOPe 2.07: d1zxlb_
  • Heterogens: NAD, JP1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zxlA (A:)
    edicfiagigdtngygwgiakelskrnvkiifgiwppvynifmknykngkfdndmiidkd
    kkmnildmlpfdasfdtandideetknnkrynmlqnytiedvanlihqkygkinmlvhsl
    anakevqkdllntsrkgyldalskssyslislckyfvnimkpqssiisltyhasqkvvpg
    ygggmssakaalesdtrvlayhlgrnynirintisagplksraatainklnntyenntnq
    nknrnshdvhnimnnsgekeekknsasqnytfidyaieysekyaplrqkllstdigsvas
    fllsresraitgqtiyvdnglnimflpddiyrnene
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zxlA (A:)
    edicfiagigdtngygwgiakelskrnvkiifgiwppvynifmknykngkfdndmiidkd
    kkmnildmlpfdasfdtandideetknnkrynmlqnytiedvanlihqkygkinmlvhsl
    anakevqkdllntsrkgyldalskssyslislckyfvnimkpqssiisltyhasqkvvpg
    ygggmssakaalesdtrvlayhlgrnynirintisagplksraatainytfidyaieyse
    kyaplrqkllstdigsvasfllsresraitgqtiyvdnglnimflpdd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zxlB (B:)
    edicfiagigdtngygwgiakelskrnvkiifgiwppvynifmknykngkfdndmiidkd
    kkmnildmlpfdasfdtandideetknnkrynmlqnytiedvanlihqkygkinmlvhsl
    anakevqkdllntsrkgyldalskssyslislckyfvnimkpqssiisltyhasqkvvpg
    ygggmssakaalesdtrvlayhlgrnynirintisagplksraatainklnntyenntnq
    nknrnshdvhnimnnsgekeekknsasqnytfidyaieysekyaplrqkllstdigsvas
    fllsresraitgqtiyvdnglnimflpddiyrnene
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zxlB (B:)
    edicfiagigdtngygwgiakelskrnvkiifgiwppvynifmknykngkfdndmiidkd
    kkmnildmlpfdasfdtandideetknnkrynmlqnytiedvanlihqkygkinmlvhsl
    anakevqkdllntsrkgyldalskssyslislckyfvnimkpqssiisltyhasqkvvpg
    ygggmssakaalesdtrvlayhlgrnynirintisagplksraatainytfidyaieyse
    kyaplrqkllstdigsvasfllsresraitgqtiyvdnglnimflpdd