PDB entry 1zxi

View 1zxi on RCSB PDB site
Description: Reconstituted CO dehydrogenase from Oligotropha carboxidovorans
Class: oxidoreductase
Keywords: Molybdoprotein, CODH, Molybdenum
Deposited on 2005-06-08, released 2005-10-11
The last revision prior to the SCOP 1.73 freeze date was dated 2005-10-11, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.166
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbon monoxide dehydrogenase small chain
    Species: Oligotropha carboxidovorans
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1zxia1, d1zxia2
  • Chain 'B':
    Compound: Carbon monoxide dehydrogenase large chain
    Species: Oligotropha carboxidovorans
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19919 (Start-808)
      • conflict (669)
    Domains in SCOP 1.73: d1zxib1, d1zxib2
  • Chain 'C':
    Compound: Carbon monoxide dehydrogenase medium chain
    Species: Oligotropha carboxidovorans
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19920 (0-End)
      • conflict (210)
    Domains in SCOP 1.73: d1zxic1, d1zxic2
  • Chain 'D':
    Compound: Carbon monoxide dehydrogenase small chain
    Species: Oligotropha carboxidovorans
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1zxid1, d1zxid2
  • Chain 'E':
    Compound: Carbon monoxide dehydrogenase large chain
    Species: Oligotropha carboxidovorans
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19919 (Start-808)
      • conflict (669)
  • Chain 'F':
    Compound: Carbon monoxide dehydrogenase medium chain
    Species: Oligotropha carboxidovorans
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19920 (0-End)
      • conflict (210)
    Domains in SCOP 1.73: d1zxif1, d1zxif2
  • Heterogens: CU, PO4, FES, CUM, MCN, FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zxiA (A:)
    makahieltinghpvealveprtllihfireqqnltgahigcdtshcgactvdldgmsvk
    sctmfavqangasittiegmaapdgtlsalqegfrmmhglqcgyctpgmimrshrllqen
    pspteaeirfgiggnlcrctgyqnivkaiqyaaakingvpfeeaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zxiA (A:)
    kahieltinghpvealveprtllihfireqqnltgahigcdtshcgactvdldgmsvksc
    tmfavqangasittiegmaapdgtlsalqegfrmmhglqcgyctpgmimrshrllqenps
    pteaeirfgiggnlcrctgyqnivkaiqyaaakingvpfee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zxiB (B:)
    mniqttveptsaeraeklqgmgckrkrvedirftqgkgnyvddvklpgmlfgdfvrssha
    hariksidtskakalpgvfavltaadlkplnlhymptlagdvqavladekvlfqnqevaf
    vvakdryvaadaielvevdyeplpvlvdpfkamepdapllredikdkmtgahgarkhhnh
    ifrweigdkegtdatfakaevvskdmftyhrvhpspletcqcvasmdkikgeltlwgtfq
    aphvirtvvslisglpehkihviapdigggfgnkvgaysgyvcavvasivlgvpvkwved
    rmenlsttsfardyhmttelaatkdgkilamrchvladhgafdacadpskwpagfmnict
    gsydmpvahlavdgvytnkasggvayrcsfrvteavyaieraietlaqrlemdsadlrik
    nfiqpeqfpymaplgweydsgnyplamkkamdtvgyhqlraeqkakqeafkrgetreimg
    igisffteivgagpskncdilgvsmfdsaeirihptgsviarmgtksqgqghettyaqii
    atelgipaddimieegntdtapyglgtygsrstptagaatavaarkikakaqmiaahmle
    vhegdlewdvdrfrvkglpekfktmkelawasynspppnlepgleavnyydppnmtypfg
    ayfcimdididtgvaktrrfyalddcgtrinpmiiegqvhgglteafavamgqeirydeq
    gnvlgasfmdfflptavetpkwetdytvtpsphhpigakgvgesphvggvpcfsnavnda
    yaflnaghiqmphdawrlwkvgeqlglhv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zxiB (B:)
    tveptsaeraeklqgmgckrkrvedirftqgkgnyvddvklpgmlfgdfvrsshaharik
    sidtskakalpgvfavltaadlkplnlhymptlagdvqavladekvlfqnqevafvvakd
    ryvaadaielvevdyeplpvlvdpfkamepdapllredikdkmtgahgarkhhnhifrwe
    igdkegtdatfakaevvskdmftyhrvhpspletcqcvasmdkikgeltlwgtfqaphvi
    rtvvslisglpehkihviapdigggfgnkvgaysgyvcavvasivlgvpvkwvedrmenl
    sttsfardyhmttelaatkdgkilamrchvladhgafdacadpskwpagfmnictgsydm
    pvahlavdgvytnkasggvayrcsfrvteavyaieraietlaqrlemdsadlriknfiqp
    eqfpymaplgweydsgnyplamkkamdtvgyhqlraeqkakqeafkrgetreimgigisf
    fteivgagpskncdilgvsmfdsaeirihptgsviarmgtksqgqghettyaqiiatelg
    ipaddimieegntdtapyglgtygsrstptagaatavaarkikakaqmiaahmlevhegd
    lewdvdrfrvkglpekfktmkelawasynspppnlepgleavnyydppnmtypfgayfci
    mdididtgvaktrrfyalddcgtrinpmiiegqvhgglteafavamgqeirydeqgnvlg
    asfmdfflptavetpkwetdytvtpsphhpigakgvgesphvggvpcfsnavndayafln
    aghiqmphdawrlwkvgeqlglhv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1zxiC (C:)
    mipgsfdyhrpksiadavalltklgedarplagghslipimktrlatpehlvdlrdigdl
    vgireegtdvvigamttqhaligsdflaaklpiiretslliadpqirymgtiggnaangd
    pgndmpalmqclgaayeltgpegarivaardyyqgayftaiepgelltairipvpptghg
    yayeklkrkigdyataaaavvltmsggkcvsasigltnvantplwaeeagkvlvgtaldk
    paldkavalaeaitapasdgrgpaeyrtkmagvmlrraverakarakn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zxiC (C:)
    mipgsfdyhrpksiadavalltklgedarplagghslipimktrlatpehlvdlrdigdl
    vgireegtdvvigamttqhaligsdflaaklpiiretslliadpqirymgtiggnaangd
    pgndmpalmqclgaayeltgpegarivaardyyqgayftaiepgelltairipvpptghg
    yayeklkrkigdyataaaavvltmsggkcvsasigltnvantplwaeeagkvlvgtaldk
    paldkavalaeaitapasdgrgpaeyrtkmagvmlrraverakarak
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1zxiD (D:)
    makahieltinghpvealveprtllihfireqqnltgahigcdtshcgactvdldgmsvk
    sctmfavqangasittiegmaapdgtlsalqegfrmmhglqcgyctpgmimrshrllqen
    pspteaeirfgiggnlcrctgyqnivkaiqyaaakingvpfeeaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zxiD (D:)
    kahieltinghpvealveprtllihfireqqnltgahigcdtshcgactvdldgmsvksc
    tmfavqangasittiegmaapdgtlsalqegfrmmhglqcgyctpgmimrshrllqenps
    pteaeirfgiggnlcrctgyqnivkaiqyaaakingvp
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1zxiF (F:)
    mipgsfdyhrpksiadavalltklgedarplagghslipimktrlatpehlvdlrdigdl
    vgireegtdvvigamttqhaligsdflaaklpiiretslliadpqirymgtiggnaangd
    pgndmpalmqclgaayeltgpegarivaardyyqgayftaiepgelltairipvpptghg
    yayeklkrkigdyataaaavvltmsggkcvsasigltnvantplwaeeagkvlvgtaldk
    paldkavalaeaitapasdgrgpaeyrtkmagvmlrraverakarakn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zxiF (F:)
    mipgsfdyhrpksiadavalltklgedarplagghslipimktrlatpehlvdlrdigdl
    vgireegtdvvigamttqhaligsdflaaklpiiretslliadpqirymgtiggnaangd
    pgndmpalmqclgaayeltgpegarivaardyyqgayftaiepgelltairipvpptghg
    yayeklkrkigdyataaaavvltmsggkcvsasigltnvantplwaeeagkvlvgtaldk
    paldkavalaeaitapasdgrgpaeyrtkmagvmlrraverakara