PDB entry 1zxg

View 1zxg on RCSB PDB site
Description: Solution structure of A219
Class: Immune System/Protein Binding
Keywords: NMR, IgG-binding, protein A, phage display, Immune System/Protein Binding COMPLEX
Deposited on 2005-06-08, released 2005-11-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: immunoglobulin g binding protein a
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q53759 (1-58)
      • initiating methionine (0)
      • engineered (1-7)
      • see remark 999 (15)
      • see remark 999 (24)
      • engineered (28)
      • see remark 999 (43)
      • see remark 999 (48)
      • engineered (53)
    Domains in SCOPe 2.08: d1zxga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zxgA (A:)
    myylvvnkqqnafyevlnmpnlnedqrnafiqslkddpsqsanvlaeaqklndvqapka