PDB entry 1zxf

View 1zxf on RCSB PDB site
Description: Solution structure of a self-sacrificing resistance protein, CalC from Micromonospora echinospora
Class: toxin
Keywords: Self-Sacrificing Resistance Protein, Structural Genomics, PSI, Protein Structure Initiative, Center for Eukaryotic Structural Genomics, CESG, TOXIN
Deposited on 2005-06-08, released 2005-12-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CalC
    Species: Micromonospora echinospora [TaxId:1877]
    Gene: CalC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zxfa1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zxfA (A:)
    nydpfvrhsvtvkadrktafktflegfpewwpnnfrttkvgaplgvdkkggrwyeideqg
    eehtfglirkvdepdtlvigwrlngfgridpdnsseftvtfvadgqkktrvdvehthfdr
    mgtkhakrvrngmdkgwptilqsfqdkideegakk