PDB entry 1zx8

View 1zx8 on RCSB PDB site
Description: Crystal structure of a proteins with an atypical cyclophilin (peptidylprolyl isomerase) fold (TM1367) from Thermotoga maritima at 1.90 A resolution.
Class: structural genomics, unknown function
Keywords: tm1367, hypothetical protein, Structural Genomics, PSI, Protein Structure Initiative, Joint Center for Structural Genomics, JCSG
Deposited on 2005-06-07, released 2005-07-26
The last revision prior to the SCOP 1.73 freeze date was dated 2006-10-03, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.166
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein TM1367
    Species: Thermotoga maritima
    Gene: tm1367
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X187 (12-135)
      • leader sequence (9-11)
      • modified residue (12)
      • modified residue (65)
      • modified residue (95)
    Domains in SCOP 1.73: d1zx8a1
  • Chain 'B':
    Compound: hypothetical protein TM1367
    Species: Thermotoga maritima
    Gene: tm1367
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X187 (12-135)
      • leader sequence (9-11)
      • modified residue (12)
      • modified residue (65)
      • modified residue (95)
    Domains in SCOP 1.73: d1zx8b1
  • Chain 'C':
    Compound: hypothetical protein TM1367
    Species: Thermotoga maritima
    Gene: tm1367
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X187 (12-End)
      • leader sequence (7-11)
      • modified residue (12)
      • modified residue (65)
      • modified residue (95)
    Domains in SCOP 1.73: d1zx8c1
  • Heterogens: NI, 1PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zx8A (A:)
    mgsdkihhhhhhmrvellfesgkcvidlneeyevvkllkekipfesvvntwgeeiyfstp
    vnvqkmenprevveigdvgywppgkalclffgktpmsddkiqpasavnvigkivegledl
    kkikdgekvavrfass
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zx8A (A:)
    hhhmrvellfesgkcvidlneeyevvkllkekipfesvvntwgeeiyfstpvnvqkmenp
    revveigdvgywppgkalclffgktpmsddkiqpasavnvigkivegledlkkikdgekv
    avrfass
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zx8B (B:)
    mgsdkihhhhhhmrvellfesgkcvidlneeyevvkllkekipfesvvntwgeeiyfstp
    vnvqkmenprevveigdvgywppgkalclffgktpmsddkiqpasavnvigkivegledl
    kkikdgekvavrfass
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zx8B (B:)
    hhhmrvellfesgkcvidlneeyevvkllkekipfesvvntwgeeiyfstpvnvqkmenp
    revveigdvgywppgkalclffgktpmsddkiqpasavnvigkivegledlkkikdgekv
    avrfass
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1zx8C (C:)
    mgsdkihhhhhhmrvellfesgkcvidlneeyevvkllkekipfesvvntwgeeiyfstp
    vnvqkmenprevveigdvgywppgkalclffgktpmsddkiqpasavnvigkivegledl
    kkikdgekvavrfass
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zx8C (C:)
    hhhhhmrvellfesgkcvidlneeyevvkllkekipfesvvntwgeeiyfstpvnvqkme
    nprevveigdvgywppgkalclffgktpmsddkiqpasavnvigkivegledlkkikdge
    kvavrfas