PDB entry 1zx8

View 1zx8 on RCSB PDB site
Description: CRYSTAL STRUCTURE OF an atypical cyclophilin (peptidylprolyl cis-trans isomerase) (TM1367) FROM THERMOTOGA MARITIMA AT 1.90 A RESOLUTION
Class: unknown function
Keywords: structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi, unknown function
Deposited on 2005-06-07, released 2005-07-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.166
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein TM1367
    Species: Thermotoga maritima [TaxId:2336]
    Gene: tm1367
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X187 (12-135)
      • leader sequence (9-11)
      • modified residue (12)
      • modified residue (65)
      • modified residue (95)
    Domains in SCOPe 2.08: d1zx8a1, d1zx8a2
  • Chain 'B':
    Compound: hypothetical protein TM1367
    Species: Thermotoga maritima [TaxId:2336]
    Gene: tm1367
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X187 (12-135)
      • leader sequence (9-11)
      • modified residue (12)
      • modified residue (65)
      • modified residue (95)
    Domains in SCOPe 2.08: d1zx8b2, d1zx8b3
  • Chain 'C':
    Compound: hypothetical protein TM1367
    Species: Thermotoga maritima [TaxId:2336]
    Gene: tm1367
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X187 (12-End)
      • leader sequence (7-11)
      • modified residue (12)
      • modified residue (65)
      • modified residue (95)
    Domains in SCOPe 2.08: d1zx8c2, d1zx8c3
  • Heterogens: NI, 1PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zx8A (A:)
    mgsdkihhhhhhmrvellfesgkcvidlneeyevvkllkekipfesvvntwgeeiyfstp
    vnvqkmenprevveigdvgywppgkalclffgktpmsddkiqpasavnvigkivegledl
    kkikdgekvavrfass
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zx8A (A:)
    hhhmrvellfesgkcvidlneeyevvkllkekipfesvvntwgeeiyfstpvnvqkmenp
    revveigdvgywppgkalclffgktpmsddkiqpasavnvigkivegledlkkikdgekv
    avrfass
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zx8B (B:)
    mgsdkihhhhhhmrvellfesgkcvidlneeyevvkllkekipfesvvntwgeeiyfstp
    vnvqkmenprevveigdvgywppgkalclffgktpmsddkiqpasavnvigkivegledl
    kkikdgekvavrfass
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zx8B (B:)
    hhhmrvellfesgkcvidlneeyevvkllkekipfesvvntwgeeiyfstpvnvqkmenp
    revveigdvgywppgkalclffgktpmsddkiqpasavnvigkivegledlkkikdgekv
    avrfass
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1zx8C (C:)
    mgsdkihhhhhhmrvellfesgkcvidlneeyevvkllkekipfesvvntwgeeiyfstp
    vnvqkmenprevveigdvgywppgkalclffgktpmsddkiqpasavnvigkivegledl
    kkikdgekvavrfass
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zx8C (C:)
    hhhhhmrvellfesgkcvidlneeyevvkllkekipfesvvntwgeeiyfstpvnvqkme
    nprevveigdvgywppgkalclffgktpmsddkiqpasavnvigkivegledlkkikdge
    kvavrfas