PDB entry 1zx3

View 1zx3 on RCSB PDB site
Description: Structure of NE0241 Protein of Unknown Function from Nitrosomonas europaea
Class: structural genomics, unknown function
Keywords: hypothetical protein NE0241, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2005-06-06, released 2005-07-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.219
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein NE0241
    Species: Nitrosomonas europaea [TaxId:228410]
    Gene: NE0241
    Database cross-references and differences (RAF-indexed):
    • GB NP_840335
      • modified residue (38)
      • modified residue (44)
      • modified residue (47)
    Domains in SCOPe 2.08: d1zx3a1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zx3A (A:)
    mgsshhhhhhssgrenlyfqghmgkkknkktevqqpdpmrknwimenmdsgviylleswl
    kaksqetgkeisdifanavefnivlkdwgkekleetnteyqnqqrklrktyieyydremk
    gs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zx3A (A:)
    evqqpdpmrknwimenmdsgviylleswlkaksqetgkeisdifanavefnivlkdwgke
    kleetnteyqnqqrklrktyieyydr