PDB entry 1zwy

View 1zwy on RCSB PDB site
Description: Crystal structure of protein VC0702 from Vibrio cholerae
Class: structural genomics, unknown function
Keywords: hypothetical protein, structural genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2005-06-06, released 2005-07-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.183
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical UPF0244 protein VC0702
    Species: Vibrio cholerae [TaxId:666]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KU27
      • modified residue (11)
      • modified residue (56)
      • modified residue (98)
      • modified residue (115)
      • modified residue (134)
    Domains in SCOPe 2.07: d1zwya1
  • Chain 'B':
    Compound: Hypothetical UPF0244 protein VC0702
    Species: Vibrio cholerae [TaxId:666]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KU27 (2-End)
      • cloning artifact (0-1)
      • modified residue (2)
      • modified residue (11)
      • modified residue (56)
      • modified residue (98)
      • modified residue (115)
      • modified residue (134)
    Domains in SCOPe 2.07: d1zwyb2, d1zwyb3
  • Chain 'C':
    Compound: Hypothetical UPF0244 protein VC0702
    Species: Vibrio cholerae [TaxId:666]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KU27 (Start-184)
      • modified residue (11)
      • modified residue (56)
      • modified residue (98)
      • modified residue (115)
      • modified residue (134)
    Domains in SCOPe 2.07: d1zwyc_
  • Chain 'D':
    Compound: Hypothetical UPF0244 protein VC0702
    Species: Vibrio cholerae [TaxId:666]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KU27
      • modified residue (11)
      • modified residue (56)
      • modified residue (98)
      • modified residue (115)
      • modified residue (134)
    Domains in SCOPe 2.07: d1zwyd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zwyA (A:)
    namppiikrrvmrkiiiasqnpakvnavrsafstvfpdqewefigvsvpsevadqpmsde
    etkqgalnrvrnakqrhpgaeyyvgleagieenktfawmivesdqqrgesrsaclmlppl
    vlerlrqakelgdvmdevfgtenikqkggaiglltrhhltrstvyhqalilalipfinpe
    hypsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zwyA (A:)
    vmrkiiiasqnpakvnavrsafstvfpdqewefigvsvpsevadqpmsdeetkqgalnrv
    rnakqrhpgaeyyvgleagieenktfawmivesdqqrgesrsaclmlpplvlerlrqael
    gdvmdevfgggaiglltrhhltrstvyhqalilalipfinpehyp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zwyB (B:)
    namppiikrrvmrkiiiasqnpakvnavrsafstvfpdqewefigvsvpsevadqpmsde
    etkqgalnrvrnakqrhpgaeyyvgleagieenktfawmivesdqqrgesrsaclmlppl
    vlerlrqakelgdvmdevfgtenikqkggaiglltrhhltrstvyhqalilalipfinpe
    hypsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zwyB (B:)
    namppiikrrvmrkiiiasqnpakvnavrsafstvfpdqewefigvsvpsevadqpmsde
    etkqgalnrvrnakqrhpgaeyyvgleagieenktfawmivesdqqrgesrsaclmlppl
    vlerlelgdvmdevfgtenikqkggaiglltrhhltrstvyhqalilalipfinpehyps
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1zwyC (C:)
    namppiikrrvmrkiiiasqnpakvnavrsafstvfpdqewefigvsvpsevadqpmsde
    etkqgalnrvrnakqrhpgaeyyvgleagieenktfawmivesdqqrgesrsaclmlppl
    vlerlrqakelgdvmdevfgtenikqkggaiglltrhhltrstvyhqalilalipfinpe
    hypsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zwyC (C:)
    vmrkiiiasqnpakvnavrsafstvfpdqewefigvsvpsevadqpmsdeetkqgalnrv
    rnakqrhpgaeyyvgleagieenktfawmivesdqqrgesrsaclmlpplvlerlrelgd
    vmdevfgtenikqkggaiglltrhhltrstvyhqalilalipfinpehypsa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1zwyD (D:)
    namppiikrrvmrkiiiasqnpakvnavrsafstvfpdqewefigvsvpsevadqpmsde
    etkqgalnrvrnakqrhpgaeyyvgleagieenktfawmivesdqqrgesrsaclmlppl
    vlerlrqakelgdvmdevfgtenikqkggaiglltrhhltrstvyhqalilalipfinpe
    hypsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zwyD (D:)
    mrkiiiasqnpakvnavrsafstvfpdqewefigvsvpsevadqpmsdeetkqgalnrvr
    nakqrhpgaeyyvgleagieenktfawmivesdqqrgesrsaclmlpplvlerlrqakel
    gdvmdevfgtenikqkggaiglltrhhltrstvyhqalilalipfinpehyps