PDB entry 1zwx

View 1zwx on RCSB PDB site
Description: Crystal Structure of SmcL
Class: hydrolase
Keywords: DNase1-like fold, beta-hairpin, HYDROLASE
Deposited on 2005-06-06, released 2005-08-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.203
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sphingomyelinase-c
    Species: Listeria ivanovii [TaxId:1638]
    Gene: smcl
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RLV9
      • see remark 999 (152)
      • see remark 999 (208)
    Domains in SCOPe 2.06: d1zwxa1
  • Heterogens: PO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zwxA (A:)
    mqasdeypgnfkitshnvylfsrniypnwgqmhradliaqadymknndvvilneafdtsa
    shrllnnlremyphqtpvigrskhgwdktegnysnfaledggvavvsqwpiveksqhifq
    rgggadrlsnkgfayvkimkngkpyhiigthtqaddsliskdtsrairaeqmqeiqtfia
    kknipkdeiifiggdlnvnygtdeyhdmlkllnvsspanfngqmatwdpttnsmlkesyp
    kaapeyldyifvengharphswhnkvlhtkspqwsvkswfktytyqdfsdhypvvgftdn
    n
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zwxA (A:)
    ypgnfkitshnvylfsrniypnwgqmhradliaqadymknndvvilneafdtsashrlln
    nlremyphqtpvigrskhgwdktegaledggvavvsqwpiveksqhifqrgggadrlsnk
    gfayvkimkngkpyhiigthtqaddsliskdtsrairaeqmqeiqtfiakknipkdeiif
    iggdlnvnygtdeyhdmlkllnvsspanfngqmatwdpttnsmlkesypkaapeyldyif
    vengharphswhnkvlhtkspqwsvkswfktytyqdfsdhypvvgftd