PDB entry 1zws

View 1zws on RCSB PDB site
Description: Crystal structure of the catalytic domain of human DRP-1 kinase
Class: transferase
Keywords: protein kinase, twinning, TRANSFERASE
Deposited on 2005-06-06, released 2006-10-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DAP-kinase related protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zwsa_
  • Chain 'B':
    Compound: DAP-kinase related protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zwsb_
  • Chain 'C':
    Compound: DAP-kinase related protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zwsc_
  • Chain 'D':
    Compound: DAP-kinase related protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zwsd_
  • Chain 'E':
    Compound: DAP-kinase related protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zwse_
  • Chain 'F':
    Compound: DAP-kinase related protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zwsf_
  • Chain 'G':
    Compound: DAP-kinase related protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zwsg_
  • Chain 'H':
    Compound: DAP-kinase related protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zwsh_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zwsA (A:)
    gmepfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsre
    eierevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsf
    ikqildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifg
    tpefvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitsvsydfdee
    ffshtselakdfirkllvketrkrltiqealrhpwitpvdnqqamvrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zwsA (A:)
    epfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsreei
    erevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsfik
    qildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifgtp
    efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitsvsydfdeeff
    shtselakdfirkllvketrkrltiqealrhpwitpvd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zwsB (B:)
    gmepfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsre
    eierevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsf
    ikqildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifg
    tpefvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitsvsydfdee
    ffshtselakdfirkllvketrkrltiqealrhpwitpvdnqqamvrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zwsB (B:)
    epfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsreei
    erevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsfik
    qildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifgtp
    efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitsvsydfdeeff
    shtselakdfirkllvketrkrltiqealrhpwitpvd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1zwsC (C:)
    gmepfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsre
    eierevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsf
    ikqildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifg
    tpefvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitsvsydfdee
    ffshtselakdfirkllvketrkrltiqealrhpwitpvdnqqamvrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zwsC (C:)
    epfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsreei
    erevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsfik
    qildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifgtp
    efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitsvsydfdeeff
    shtselakdfirkllvketrkrltiqealrhpwitpvd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1zwsD (D:)
    gmepfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsre
    eierevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsf
    ikqildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifg
    tpefvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitsvsydfdee
    ffshtselakdfirkllvketrkrltiqealrhpwitpvdnqqamvrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zwsD (D:)
    epfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsreei
    erevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsfik
    qildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifgtp
    efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitsvsydfdeeff
    shtselakdfirkllvketrkrltiqealrhpwitpvd
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1zwsE (E:)
    gmepfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsre
    eierevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsf
    ikqildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifg
    tpefvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitsvsydfdee
    ffshtselakdfirkllvketrkrltiqealrhpwitpvdnqqamvrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zwsE (E:)
    epfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsreei
    erevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsfik
    qildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifgtp
    efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitsvsydfdeeff
    shtselakdfirkllvketrkrltiqealrhpwitpvd
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1zwsF (F:)
    gmepfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsre
    eierevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsf
    ikqildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifg
    tpefvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitsvsydfdee
    ffshtselakdfirkllvketrkrltiqealrhpwitpvdnqqamvrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zwsF (F:)
    epfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsreei
    erevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsfik
    qildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifgtp
    efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitsvsydfdeeff
    shtselakdfirkllvketrkrltiqealrhpwitpvd
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1zwsG (G:)
    gmepfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsre
    eierevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsf
    ikqildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifg
    tpefvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitsvsydfdee
    ffshtselakdfirkllvketrkrltiqealrhpwitpvdnqqamvrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zwsG (G:)
    epfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsreei
    erevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsfik
    qildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifgtp
    efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitsvsydfdeeff
    shtselakdfirkllvketrkrltiqealrhpwitpvd
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1zwsH (H:)
    gmepfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsre
    eierevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsf
    ikqildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifg
    tpefvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitsvsydfdee
    ffshtselakdfirkllvketrkrltiqealrhpwitpvdnqqamvrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zwsH (H:)
    epfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsreei
    erevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsfik
    qildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifgtp
    efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitsvsydfdeeff
    shtselakdfirkllvketrkrltiqealrhpwitpvd