PDB entry 1zwl

View 1zwl on RCSB PDB site
Description: Structure of WrbA from Pseudomonas aeruginosa in complex with FMN
Class: protein binding
Keywords: WrbA, FMN, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, PROTEIN BINDING
Deposited on 2005-06-03, released 2005-06-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-02-03, with a file datestamp of 2021-01-29.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trp repressor binding protein WrbA
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: wrba
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I509 (Start-204)
      • cloning artifact (205)
    Domains in SCOPe 2.08: d1zwla2, d1zwla3
  • Heterogens: FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zwlA (A:)
    mahhhhhhslsspyilvlyysrhgataemarqiargveqggfearvrtvpavsteceava
    pdipaegalyatledlkncaglalgsptrfgnmasplkyfldgtsslwltgslvgkpaav
    ftstaslhggqettqlsmllpllhhgmlvlgipysepalletrgggtpygashfagadgk
    rsldeheltlcralgkrlaetagkleg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zwlA (A:)
    pyilvlyysrhgataemarqiargveqggfearvrtvpavstgalyatledlkncaglal
    gsptrfgnmasplkyfldgtsslwltgslvgkpaavftstaslhggqettqlsmllpllh
    hgmlvlgipyggtpygashfagadgkrsldeheltlcralgkrlaetagkle