PDB entry 1zwj

View 1zwj on RCSB PDB site
Description: X-ray structure of galt-like protein from arabidopsis thaliana AT5G18200
Class: structural genomics, unknown function
Keywords: GALT, AT5G18200, STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, PSI, CESG, Center for Eukaryotic Structural Genomics, UNKNOWN FUNCTION
Deposited on 2005-06-03, released 2005-06-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative galactose-1-phosphate uridyl transferase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At5g18200
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zwja1, d1zwja2
  • Chain 'B':
    Compound: putative galactose-1-phosphate uridyl transferase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At5g18200
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zwjb1, d1zwjb2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zwjA (A:)
    mtspshasdrgggdgdsvenqspelrkdpvtnrwvifsparakrptdfkskspqnpnpkp
    sscpfcigreqecapelfrvpdhdpnwklrvienlypalsrnletqstqpetgtsrtivg
    fgfhdvviespvhsiqlsdidpvgigdiliaykkrinqiaqhdsinyiqvfknqgasaga
    smshshsqmmalpvvpptvssrldgtkdyfeetgkcclceakskhfvidesshfvsvapf
    aatypfeiwiipkdhsshfhhlddvkavdlggllklmlqkiakqlndppynymihtsplk
    vtesqlpythwflqivpqlsgvggfeigtgcyinpvfpedvakvmrevslt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zwjA (A:)
    pelrkdpvtnrwvifspfkskscpfcigreqecapelfrvpdhdpnwklrvienlypals
    rnletrtivgfgfhdvviespvhsiqlsdidpvgigdiliaykkrinqiaqhdsinyiqv
    fknqgasagasmshshsqmmalpvvpptvssrldgtkdyfeetgkcclceakskhfvide
    sshfvsvapfaatypfeiwiipkdhsshfhhlddvkavdlggllklmlqkiakqlndppy
    nymihtsplkvtesqlpythwflqivpqlsgvggfeigtgcyinpvfpedvakvmrevsl
    t
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zwjB (B:)
    mtspshasdrgggdgdsvenqspelrkdpvtnrwvifsparakrptdfkskspqnpnpkp
    sscpfcigreqecapelfrvpdhdpnwklrvienlypalsrnletqstqpetgtsrtivg
    fgfhdvviespvhsiqlsdidpvgigdiliaykkrinqiaqhdsinyiqvfknqgasaga
    smshshsqmmalpvvpptvssrldgtkdyfeetgkcclceakskhfvidesshfvsvapf
    aatypfeiwiipkdhsshfhhlddvkavdlggllklmlqkiakqlndppynymihtsplk
    vtesqlpythwflqivpqlsgvggfeigtgcyinpvfpedvakvmrevslt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zwjB (B:)
    qspelrkdpvtnrwvifsptdfksscpfciecapelfrvpdhdpnwklrvienlypalsr
    nletrtivgfgfhdvviespvhsiqlsdidpvgigdiliaykkrinqiaqhdsinyiqvf
    knqgasagasmshshsqmmalpvvpptvssrldgtkdyfeetgkcclceakskhfvides
    shfvsvapfaatypfeiwiipkdhsshfhhlddvkavdlggllklmlqkiakqlndppyn
    ymihtsplkvtesqlpythwflqivpqlsgvggfeigtgcyinpvfpedvakvmrevsl