PDB entry 1zwg

View 1zwg on RCSB PDB site
Description: succinyl human parathyroid hormone 4-37, nmr, 10 structures
Class: hormone
Keywords: hormone, signal, disease mutation
Deposited on 1996-06-17, released 1997-06-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: parathyroid hormone
  Species: Homo sapiens [TaxId:9606]
  Gene: POTENTIAL
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01270 (1-34)
  Domains in SCOPe 2.08: d1zwga1, d1zwga2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1zwgA (A:)
  xeiqlmhnlgkhlnsmervewlrkklqdvhnfval