PDB entry 1zwd

View 1zwd on RCSB PDB site
Description: structure of human parathyroid hormone fragment 3-37, nmr, 10 structures
Deposited on 1996-06-17, released 1997-03-12
The last revision was dated 2022-03-02, with a file datestamp of 2022-02-25.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: parathyroid hormone
    Species: Homo sapiens [TaxId:9606]
    Gene: POTENTIAL
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOP 1.55, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1zwdA (A:)
seiqlmhnlgkhlnsmervewlrkklqdvhnfval