PDB entry 1zwc

View 1zwc on RCSB PDB site
Description: structure of bovine parathyroid hormone fragment 1-37, nmr, 10 structures
Class: hormone
Keywords: hormone, signal, disease mutation
Deposited on 1996-06-17, released 1997-03-12
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: parathyroid hormone
  Species: Bos taurus [TaxId:9913]
  Gene: POTENTIAL
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01268 (0-36)
  Domains in SCOPe 2.01: d1zwca_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1zwcA (A:)
  avseiqfmhnlgkhlssmervewlrkklqdvhnfval