PDB entry 1zwa

View 1zwa on RCSB PDB site
Description: structure of human parathyroid hormone fragment 1-34, nmr, 10 structures
Class: hormone
Keywords: hormone, signal, disease mutation
Deposited on 1996-06-17, released 1997-03-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: parathyroid hormone
    Species: Homo sapiens [TaxId:9606]
    Gene: POTENTIAL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zwaa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zwaA (A:)
    svseiqlmhnlgkhlnsmervewlrkklqdvhnf