PDB entry 1zw6

View 1zw6 on RCSB PDB site
Description: Crystal Structure of the GTP-bound form of RasQ61G
Class: oncoprotein
Keywords: GTPase, GTP, Ras, G-protein
Deposited on 2005-06-03, released 2006-03-14
The last revision prior to the SCOP 1.75 freeze date was dated 2006-03-14, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.146
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transforming protein p21/h-ras-1
    Species: HOMO SAPIENS
    Gene: HRAS, HRAS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01112 (0-165)
      • modified residue (50)
      • engineered (60)
    Domains in SCOP 1.75: d1zw6a1
  • Heterogens: MG, CA, GNP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zw6A (A:)
    mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
    geeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
    aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh