PDB entry 1zw1

View 1zw1 on RCSB PDB site
Description: Synthesis, Biological Activity, and X-Ray Crystal Structural Analysis of Diaryl Ether Inhibitors of Malarial Enoyl ACP Reductase. Part 1:4'-Substituted Triclosan Derivatives
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2005-06-03, released 2006-06-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.228
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enoyl-acyl carrier reductase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: PfENR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1zw1a_
  • Chain 'B':
    Compound: enoyl-acyl carrier reductase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: PfENR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1zw1b_
  • Heterogens: NAD, TN5

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zw1A (A:)
    edicfiagigdtngygwgiakelskrnvkiifgiwppvynifmknykngkfdndmiidkd
    kkmnildmlpfdasfdtandideetknnkrynmlqnytiedvanlihqkygkinmlvhsl
    anakevqkdllntsrkgyldalskssyslislckyfvnimkpqssiisltyhasqkvvpg
    ygggmssakaalesdtrvlayhlgrnynirintisagplksraatainklnntyenntnq
    nknrnshdvhnimnnsgekeekknsasqnytfidyaieysekyaplrqkllstdigsvas
    fllsresraitgqtiyvdnglnimflpddiyrnene
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zw1A (A:)
    edicfiagigdtngygwgiakelskrnvkiifgiwppvynifmknykngkfdndmiidkd
    kkmnildmlpfdasfdtandideetknnkrynmlqnytiedvanlihqkygkinmlvhsl
    anakevqkdllntsrkgyldalskssyslislckyfvnimkpqssiisltyhasqkvvpg
    ygggmssakaalesdtrvlayhlgrnynirintisagplksraatainkytfidyaieys
    ekyaplrqkllstdigsvasfllsresraitgqtiyvdnglnimflpdd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zw1B (B:)
    edicfiagigdtngygwgiakelskrnvkiifgiwppvynifmknykngkfdndmiidkd
    kkmnildmlpfdasfdtandideetknnkrynmlqnytiedvanlihqkygkinmlvhsl
    anakevqkdllntsrkgyldalskssyslislckyfvnimkpqssiisltyhasqkvvpg
    ygggmssakaalesdtrvlayhlgrnynirintisagplksraatainklnntyenntnq
    nknrnshdvhnimnnsgekeekknsasqnytfidyaieysekyaplrqkllstdigsvas
    fllsresraitgqtiyvdnglnimflpddiyrnene
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zw1B (B:)
    edicfiagigdtngygwgiakelskrnvkiifgiwppvynifmknykngkfdndmiidkd
    kkmnildmlpfdasfdtandideetknnkrynmlqnytiedvanlihqkygkinmlvhsl
    anakevqkdllntsrkgyldalskssyslislckyfvnimkpqssiisltyhasqkvvpg
    ygggmssakaalesdtrvlayhlgrnynirintisagplksraatainkytfidyaieys
    ekyaplrqkllstdigsvasfllsresraitgqtiyvdnglnimflpdd