PDB entry 1zvx

View 1zvx on RCSB PDB site
Description: Crystal structure of the complex between MMP-8 and a phosphonate inhibitor (R-enantiomer)
Class: hydrolase
Keywords: stereoselective inhibition, phosphonic inhibitors, hydrolase, sulfonamide junction
Deposited on 2005-06-03, released 2006-05-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neutrophil collagenase
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP8, CLG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zvxa_
  • Heterogens: CA, ZN, FIN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1zvxA (A:)
mltpgnpkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadin
iafyqrdhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahef
ghslglahssdpgalmypnyafretsnyslpqddidgiqaiyg