PDB entry 1zvv

View 1zvv on RCSB PDB site
Description: Crystal structure of a ccpa-crh-dna complex
Class: transcription/DNA
Keywords: ccpa; crh; dna; complex; lacI member
Deposited on 2005-06-02, released 2006-02-07
The last revision prior to the SCOP 1.73 freeze date was dated 2006-10-24, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.98 Å
R-factor: 0.235
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucose-resistance amylase regulator
    Species: Bacillus subtilis
    Gene: ccpA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46828 (0-331)
      • conflict (86)
      • conflict (104)
      • conflict (319)
    Domains in SCOP 1.73: d1zvva1, d1zvva2
  • Chain 'B':
    Compound: Glucose-resistance amylase regulator
    Species: Bacillus subtilis
    Gene: ccpA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46828 (0-331)
      • conflict (86)
      • conflict (104)
      • conflict (319)
    Domains in SCOP 1.73: d1zvvb1, d1zvvb2
  • Chain 'G':
    Compound: Glucose-resistance amylase regulator
    Species: Bacillus subtilis
    Gene: ccpA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46828 (0-331)
      • conflict (86)
      • conflict (104)
      • conflict (319)
    Domains in SCOP 1.73: d1zvvg1, d1zvvg2
  • Chain 'J':
    Compound: HPr-like protein crh
    Species: Bacillus subtilis
    Gene: crh
    Database cross-references and differences (RAF-indexed):
    • Uniprot O06976 (0-End)
      • conflict (32)
      • modified residue (45)
      • conflict (54)
      • conflict (60)
  • Chain 'O':
    Compound: DNA recognition strand CRE
  • Chain 'P':
    Compound: HPr-like protein crh
    Species: Bacillus subtilis
    Gene: crh
    Database cross-references and differences (RAF-indexed):
    • Uniprot O06976 (0-End)
      • conflict (32)
      • modified residue (45)
      • conflict (54)
      • conflict (60)
  • Chain 'R':
    Compound: DNA recognition strand CRE
  • Chain 'T':
    Compound: DNA recognition strand CRE
  • Chain 'W':
    Compound: HPr-like protein crh
    Species: Bacillus subtilis
    Gene: crh
    Database cross-references and differences (RAF-indexed):
    • Uniprot O06976 (0-End)
      • conflict (32)
      • modified residue (45)
      • conflict (54)
      • conflict (60)
  • Heterogens: IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zvvA (A:)
    mnvtiydvareasvsmatvsrvvngnpnvkpstrkkvletierlgyrpnavarglaskkt
    ttvgviipdisnifyaelargiediasmykyniilsnsdqnqdkqlhllnnmlgkqvdgi
    ifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsghkni
    afvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleedekp
    taifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydigav
    amrlltkymnketvdssivelphriefrqstk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zvvB (B:)
    mnvtiydvareasvsmatvsrvvngnpnvkpstrkkvletierlgyrpnavarglaskkt
    ttvgviipdisnifyaelargiediasmykyniilsnsdqnqdkqlhllnnmlgkqvdgi
    ifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsghkni
    afvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleedekp
    taifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydigav
    amrlltkymnketvdssivelphriefrqstk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1zvvG (G:)
    mnvtiydvareasvsmatvsrvvngnpnvkpstrkkvletierlgyrpnavarglaskkt
    ttvgviipdisnifyaelargiediasmykyniilsnsdqnqdkqlhllnnmlgkqvdgi
    ifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsghkni
    afvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleedekp
    taifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydigav
    amrlltkymnketvdssivelphriefrqstk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zvvG (G:)
    mnvtiydvareasvsmatvsrvvngnpnvkpstrkkvletieyrpnavarglaskktttv
    gviipdisnifyaelargiediasmykyniilsnsdqnqdkqlhllnnmlgkqvdgiifm
    sgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsghkniafv
    sgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleedekptai
    fvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydigavamr
    lltkymnketvdssivelphriefrqstk
    

  • Chain 'J':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'R':
    No sequence available.

  • Chain 'T':
    No sequence available.

  • Chain 'W':
    No sequence available.