PDB entry 1zvp

View 1zvp on RCSB PDB site
Description: Crystal Structure of a Protein of Unknown Function VC0802 from Vibrio cholerae, Possible Transport Protein
Class: structural genomics, unknown function
Keywords: Vibrio cholerae, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2005-06-02, released 2005-07-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.216
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein VC0802
    Species: Vibrio cholerae [TaxId:666]
    Gene: GI:9655251
    Database cross-references and differences (RAF-indexed):
    • GB AAF93966
    Domains in SCOPe 2.07: d1zvpa1, d1zvpa2
  • Chain 'B':
    Compound: hypothetical protein VC0802
    Species: Vibrio cholerae [TaxId:666]
    Gene: GI:9655251
    Database cross-references and differences (RAF-indexed):
    • GB AAF93966
    Domains in SCOPe 2.07: d1zvpb1, d1zvpb2
  • Chain 'C':
    Compound: hypothetical protein VC0802
    Species: Vibrio cholerae [TaxId:666]
    Gene: GI:9655251
    Database cross-references and differences (RAF-indexed):
    • GB AAF93966 (1-End)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1zvpc1, d1zvpc2, d1zvpc3
  • Chain 'D':
    Compound: hypothetical protein VC0802
    Species: Vibrio cholerae [TaxId:666]
    Gene: GI:9655251
    Database cross-references and differences (RAF-indexed):
    • GB AAF93966 (1-End)
    Domains in SCOPe 2.07: d1zvpd1, d1zvpd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zvpA (A:)
    gmsgikslelllqsmspelmagdyvfctvngalsdylslepiatfrepegltlvleaeka
    qqaglessalfslitltvhssleavgltaafatklaehgisanviagyyhdhifvqkeka
    qqalqalgefaqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zvpA (A:)
    sgikslelllqsmspelmagdyvfctvngalsdylslepiatfrepegltlvleaekaqq
    aglessalfslitltvhseavgltaafatklaehgisanviagyyhdhifvqkekaqqal
    qalgefaq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zvpB (B:)
    gmsgikslelllqsmspelmagdyvfctvngalsdylslepiatfrepegltlvleaeka
    qqaglessalfslitltvhssleavgltaafatklaehgisanviagyyhdhifvqkeka
    qqalqalgefaqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zvpB (B:)
    sgikslelllqsmspelmagdyvfctvngalsdylslepiatfrepegltlvleaekaqq
    aglessalfslitltvhleavgltaafatklaehgisanviagyyhdhifvqkekaqqal
    qalgefaq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1zvpC (C:)
    gmsgikslelllqsmspelmagdyvfctvngalsdylslepiatfrepegltlvleaeka
    qqaglessalfslitltvhssleavgltaafatklaehgisanviagyyhdhifvqkeka
    qqalqalgefaqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zvpC (C:)
    gmsgikslelllqsmspelmagdyvfctvngalsdylslepiatfrepegltlvleaeka
    qqaglessalfslitltvsleavgltaafatklaehgisanviagyyhdhifvqkekaqq
    alqalgef
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1zvpD (D:)
    gmsgikslelllqsmspelmagdyvfctvngalsdylslepiatfrepegltlvleaeka
    qqaglessalfslitltvhssleavgltaafatklaehgisanviagyyhdhifvqkeka
    qqalqalgefaqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zvpD (D:)
    msgikslelllqsmspelmagdyvfctvngalsdylslepiatfrepegltlvleaekaq
    qaglessalfslitltvhssleavgltaafatklaehgisanviagyyhdhifvqkekaq
    qalqalgefaq