PDB entry 1zvo

View 1zvo on RCSB PDB site
Description: Semi-extended solution structure of human myeloma immunoglobulin D determined by constrained X-ray scattering
Class: immune system
Keywords: immunoglobulin fold, antibody, immune system
Deposited on 2005-06-02, released 2005-10-25
The last revision prior to the SCOPe 2.03 freeze date was dated 2010-04-07, with a file datestamp of 2010-04-02.
Experiment type: SAXS
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myeloma immunoglobulin D lambda
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1zvoa1, d1zvoa2
  • Chain 'B':
    Compound: myeloma immunoglobulin D lambda
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1zvob1, d1zvob2
  • Chain 'C':
    Compound: myeloma immunoglobulin D delta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: myeloma immunoglobulin D delta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zvoA (A:)
    qsvltqppsasgtpgqrvtiscfgsssnigryyvywyqqlpgttpklliykdnqrpsgvp
    drfsgsksgtsaslaisglrsedeadyycaawddslwvfgggttltvlsqpkaapsvtlf
    ppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyl
    sltpeqwkshrsyscqvthegstvektvaptecs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zvoB (B:)
    qsvltqppsasgtpgqrvtiscfgsssnigryyvywyqqlpgttpklliykdnqrpsgvp
    drfsgsksgtsaslaisglrsedeadyycaawddslwvfgggttltvlsqpkaapsvtlf
    ppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyl
    sltpeqwkshrsyscqvthegstvektvaptecs
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.