PDB entry 1zvf

View 1zvf on RCSB PDB site
Description: The crystal structure of 3-hydroxyanthranilate 3,4-dioxygenase from Saccharomyces cerevisiae
Class: oxidoreductase
Keywords: jellyroll beta-barrel, OXIDOREDUCTASE
Deposited on 2005-06-02, released 2006-06-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.41 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-hydroxyanthranilate 3,4-dioxygenase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P47096 (1-175)
      • expression tag (0)
      • see remark 999 (47)
    Domains in SCOPe 2.07: d1zvfa1, d1zvfa2
  • Chain 'B':
    Compound: 3-hydroxyanthranilate 3,4-dioxygenase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P47096 (1-End)
      • expression tag (0)
      • see remark 999 (47)
    Domains in SCOPe 2.07: d1zvfb2, d1zvfb3
  • Heterogens: NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zvfA (A:)
    amfnttpinidkwlkenegllkppvnnyclhkggftvmivggpnertdyhinptpewfyq
    kkgsmllkvvdetdaepkfidiiinegdsyllpgnvphspvrfadtvgivveqdrpggen
    dkirwycshcrqvvheselqmldlgtqvkeaildfendvekrtcfhcktlnyarpq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zvfB (B:)
    amfnttpinidkwlkenegllkppvnnyclhkggftvmivggpnertdyhinptpewfyq
    kkgsmllkvvdetdaepkfidiiinegdsyllpgnvphspvrfadtvgivveqdrpggen
    dkirwycshcrqvvheselqmldlgtqvkeaildfendvekrtcfhcktlnyarpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zvfB (B:)
    amfnttpinidkwlkenegllkppvnnyclhkggftvmivggpnertdyhinptpewfyq
    kkgsmllkvvdetdaepkfidiiinegdsyllpgnvphspvrfadtvgivveqdrpggen
    dkirwycshcrqvvheselqmldlgtqvkeaildfendvekrtcfhcktlny