PDB entry 1zv9

View 1zv9 on RCSB PDB site
Description: Crystal structure analysis of a type II cohesin domain from the cellulosome of Acetivibrio cellulolyticus- SeMet derivative
Class: cellulosome
Keywords: cohesins II; cellulosome
Deposited on 2005-06-01, released 2006-06-13
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-08-04, with a file datestamp of 2009-07-31.
Experiment type: XRAY
Resolution: 1.28 Å
R-factor: 0.118
AEROSPACI score: 0.81 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cellulosomal scaffoldin adaptor protein B
  Species: Acetivibrio cellulolyticus [TaxId:35830]
  Gene: ScaB
  Database cross-references and differences (RAF-indexed):
  • GB AAP48995 (0-171)
  Domains in SCOPe 2.02: d1zv9a_
• Heterogens: NO3, EDO, PDO, FMT, ACY, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1zv9A (A:)
  aptssieivldkttasvgeivtasiniknitnfsgcqlnmkydpavlqpvtssgvaytks
  tmpgagtilnsdfnlrqvadndlekgilnfskayvslddyrtaaapeqtgtvavvkfkvl
  keetssisfedttsvpnaidgtvlfdwngdriqsgysviqpavinldmikas