PDB entry 1zv9

View 1zv9 on RCSB PDB site
Description: Crystal structure analysis of a type II cohesin domain from the cellulosome of Acetivibrio cellulolyticus- SeMet derivative
Class: cellulosome
Keywords: cohesins II; cellulosome, cellulosome
Deposited on 2005-06-01, released 2006-06-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.28 Å
R-factor: N/A
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellulosomal scaffoldin adaptor protein B
    Species: Acetivibrio cellulolyticus [TaxId:35830]
    Gene: ScaB
    Database cross-references and differences (RAF-indexed):
    • GB AAP48995 (0-171)
    Domains in SCOPe 2.08: d1zv9a_
  • Heterogens: NO3, EDO, PDO, FMT, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zv9A (A:)
    aptssieivldkttasvgeivtasiniknitnfsgcqlnmkydpavlqpvtssgvaytks
    tmpgagtilnsdfnlrqvadndlekgilnfskayvslddyrtaaapeqtgtvavvkfkvl
    keetssisfedttsvpnaidgtvlfdwngdriqsgysviqpavinldmikas